PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G19070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 346aa    MW: 37712.1 Da    PI: 4.818
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G19070.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like49.11.3e-15281333254
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54 
                  p l+Wt+ L   F +av +LGG   AtPk+i el++ +gLt ++++SHLQ  R
  AT3G19070.1 281 PDLVWTNRLQLVFDDAVVRLGGLFSATPKAINELISEEGLTGDQIRSHLQVLR 333
                  5689**********************************************887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-9278337IPR009057Homeodomain-like
TIGRFAMsTIGR015579.7E-22280336IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.605.0E-13280334IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MTNLDEFLEE LSSIESHSQK IVKIDEHLKK LDEETKEDED EDAAKIIQDR STAREAEIAL  60
LMDLRQNFLP PPSMSSSSLQ PPSSSTLAPS SSSSLQPPAP LIDFFRSSVS YSHQPPSSST  120
LATSSSPSLQ PPSMSSSSLQ PPASLREFFT SSVSYSHQPS SSSTLATSSF FPSSMPYSVR  180
PPDSSDRPSL REFFPSSPSS SIQPPESSSS KRARLSNIFP SPLSSSPSPF VNPFLRPQAQ  240
EPTIPNFINP IPQISPGLPA LFPNPNPNPN PNPIPNPIRN PDLVWTNRLQ LVFDDAVVRL  300
GGLFSATPKA INELISEEGL TGDQIRSHLQ VLRDRQKAIA DKLALE
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO184021010.0
Genevisible256949_at0.0
Expression AtlasAT3G19070-
AtGenExpressAT3G19070-
ATTED-IIAT3G19070-
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G19070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G19070
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0007350.0AP000735.1 Arabidopsis thaliana genomic DNA, chromosome 3, TAC clone:K13E13.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_188537.10.0homeodomain-like superfamily protein
TrEMBLF4J9Z80.0F4J9Z8_ARATH; Homeodomain-like superfamily protein
STRINGAT3G19070.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2325233
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]